Lepirudin Powder CAS 138068-37-8 | High Purity Recombinant Hirudin Peptide Supplier China

Core Selling Points

✅ ≥98% HPLC Purity Research-Grade Peptide Material

✅ LC-MS Full Modified Decapeptide Sequence Verification

✅ Batch-Specific COA, HPLC & MS Test Reports Available

✅ Fmoc SPPS Production, In-house QC Laboratory

✅ Global Export Documentation & Cross-border Logistics Support

✅ Custom Modified Peptide Synthesis & Lyophilization Service

What Is Lepirudin Powder?

Lepirudin powder is a recombinant hirudin analogue, a 65-amino-acid polypeptide known as a potent, selective direct thrombin inhibitor. Derived from modifications of natural medicinal leech hirudin, it binds irreversibly to both free and clot-bound thrombin, making it an essential research tool for thrombosis, coagulation and heparin-induced thrombocytopenia (HIT) studies.

HDM BIO produces high-quality Lepirudin powder with strict control of disulfide bond configuration, peptide purity and impurity removal. Our manufacturing workflow ensures stable biochemical activity and consistent batch-to-batch performance. We serve global biotech laboratories, thrombosis research institutions and pharmaceutical R&D teams with lab sample supply and large-scale bulk orders. This peptide raw material is for laboratory research use only and cannot be directly used for human clinical administration.

What Are the Official Quality Specifications of Lepirudin Powder?

Every production batch of Lepirudin undergoes dual QC testing (HPLC + LC-MS) within HDM BIO's analytical laboratory. Independent batch COA will be issued for all procurement orders.

Item	Specification	Result
Appearance	White to off-white powder	Consistent
Purity (HPLC)	≥98%	99.46%
MS Identity	Consistent with reference standard	Confirmed
Conclusion	Cosmetic raw material requirement	Passed

Lepirudin vs Other Direct Thrombin Inhibitor Peptides

For buyers sourcing anticoagulant peptides for thrombosis and HIT research, this comparison clarifies core differences for raw material selection:

Product	Target Mechanism	Structural Feature	Primary Research Application	CAS Number
Lepirudin	Irreversible direct thrombin inhibitor; binds free & clot-bound thrombin	65 aa recombinant hirudin variant	HIT mechanism, anticoagulation & thrombus research	138068-37-8
Desirudin	Irreversible thrombin inhibitor, hirudin analogue	Modified recombinant hirudin	Venous thrombosis preclinical evaluation	120993-53-5
Bivalirudin	Reversible direct thrombin inhibitor	Synthetic 20-amino-acid peptide	Interventional cardiology coagulation research	128270-60-0

This section covers long-tail keywords: lepirudin vs desirudin, lepirudin vs bivalirudin, recombinant hirudin peptide supplier.

How to Buy Lepirudin Powder from a Reliable Supplier?

When sourcing Lepirudin powder for coagulation pharmacology and thrombotic disease research, R&D teams and international peptide buyers should evaluate five core criteria to avoid quality risks:

HPLC purity validation: Confirm ≥98% purity alongside complete impurity chromatograms
LC-MS structural confirmation: Verify full-length peptide sequence and correct disulfide bond arrangement
Batch-specific documentation: Guarantee each order can be matched with independent COA reports
Mature manufacturing capability: Select suppliers with experience producing long-chain cysteine-rich polypeptides
Global export service: Confirm suppliers can provide complete supporting documents for customs clearance worldwide

HDM BIO supplies research-grade Lepirudin with full quality records, flexible minimum order quantities and worldwide shipping for small trial batches and long-term bulk procurement.

Lepirudin Powder Price & Bulk Ordering Guide 2026

Buyers searching for Lepirudin powder price, bulk API quotation and delivery terms can refer to key procurement information below:

Minimum Order Quantity: Flexible MOQ, milligram & gram-level trial samples available; kilogram bulk supply for continuous research projects
Sample Pricing: Trial samples for laboratory assessment; contact sales team to acquire sample quotation
Bulk Kilogram Quotation: Tiered pricing policy, larger bulk orders enjoy competitive unit cost
Production Lead Time: Standard lead time depends on order volume; sales will confirm exact production schedule upon formal inquiry
Shipping Options: Cold-chain transportation to maintain peptide stability; we provide commercial invoice, packing list and MSDS for global customs clearance

Multiple factors influence the final quotation: purity grade, customized testing requirements, special packaging specifications and cold-chain logistics fees. Contact our sales team for up-to-date formal quotation.

Lepirudin Powder Procurement Guide for Global Buyers

Before signing purchase contracts for long-chain modified peptide raw materials, international procurement teams should complete these verification steps to mitigate potential risks:

Supplier verification: Confirm the supplier owns independent peptide synthesis workshop and in-house QC laboratory
Document inspection: Request pre-shipment batch COA, HPLC chromatogram and LC-MS identity report
Product confirmation: Check peptide purity standard, disulfide bond activity and storage specifications match your experimental design
MOQ & lead time: Confirm stock availability, production cycle and order adjustment policy
Shipping documents: Confirm the supplier can provide all required files for import customs clearance in your region

About HDM BIO Lepirudin Manufacturing Capability

HDM BIO owns over 10 years of experience focused on peptide synthesis and cysteine-rich long-chain polypeptide raw material manufacturing.

Dedicated production lines optimized for long polypeptides with multiple disulfide bridges
Independent analytical laboratory equipped with HPLC, LC-MS, moisture tester and heavy metal testing instruments
Peptide products exported to more than 70 countries, serving university labs, biotech startups and pharmaceutical R&D institutes
Stable annual production capacity for research-grade peptide raw materials, supporting long-term framework cooperation
Professional technical team with rich experience in long-chain peptide folding, oxidation and purification

Our peptide manufacturing facility operates dedicated peptide production lines with in-house HPLC purification and LC-MS analytical capability.

What Technical Challenges Exist in Lepirudin Synthesis & Production?

Lepirudin is a 65-amino-acid polypeptide containing three pairs of disulfide bonds. Correct oxidative folding is the major technical barrier separating qualified manufacturers from low-grade suppliers.

Core production difficulties include:

Controlled oxidative folding to avoid mismatched disulfide bond isomers
Prevention of peptide chain hydrolysis and degradation during purification
Efficient separation of misfolded impurities via multi-stage chromatography
Consistent preservation of biological anticoagulant activity after lyophilization
Stable batch repeatability for long-chain complex polypeptides

HDM BIO adopts optimized folding protocols, multi-stage gradient HPLC purification and full-process LC-MS monitoring for each batch. This minimizes misfolded impurities and guarantees complete peptide sequence integrity and stable biological activity.

How Does Lepirudin Work in Laboratory Research?

As a direct, irreversible thrombin inhibitor, Lepirudin powder binds simultaneously to thrombin's catalytic active site and fibrinogen exosite. It inhibits both circulating free thrombin and thrombin trapped within clots, blocking fibrin generation, platelet activation and downstream coagulation cascades.

It is widely used as core research material for heparin-induced thrombocytopenia (HIT), thromboembolic disease, anticoagulant drug screening and comparative coagulation pharmacology. All mechanism descriptions apply only to in vitro and preclinical animal research scenarios.

How Is Lepirudin Powder Manufactured at HDM BIO?

Lepirudin requires strict control of amino acid assembly and oxidative folding to achieve correct tertiary structure.

Read related guide: Modified Peptide API Manufacturing Guide | Fmoc SPPS Technology Explained

Complete Lepirudin Manufacturing Workflow

Raw Material Inspection → Peptide Assembly → Cleavage & Deprotection → Controlled Oxidative Folding → Multi-stage HPLC Purification → Vacuum Lyophilization → Full QC Testing → Batch COA Issuance → Sealed Light-Proof Packaging

QC Inspection Workflow

Incoming Raw Material QC → In-process folding monitoring → HPLC Purity Testing → Mass Spectrometry Identity Verification → Disulfide bond mapping → Moisture & Heavy Metal Testing → Residual Solvent Detection → Final Batch Release Approval

Core Process Highlights

Precision oxidative folding technology to reduce disulfide mismatch impurities

Multi-stage high-precision HPLC purification thoroughly removes misfolded peptide variants

Full-structure LC-MS verification confirms intact polypeptide sequence

Vacuum lyophilization and light-proof sealed packaging preserve peptide stability during transport and low-temperature storage

What Are the Main Application Scenarios of Lepirudin Powder?

Coagulation pharmacology research: Thrombin inhibition mechanism and anticoagulant pathway experiments
Heparin-induced thrombocytopenia (HIT) preclinical study: HIT-related thrombosis model research
Thrombus disease research: Arterial and venous thromboembolism mechanism exploration
Biomedical reagent preparation: Laboratory reference standards and experimental control reagents
Novel anticoagulant drug screening: Comparative evaluation of direct thrombin inhibitor candidates

Why Choose HDM BIO As Your Lepirudin Powder Supplier?

10+ years of professional long-chain polypeptide raw material manufacturing experience in China
Mature folding technology for cysteine-rich peptides with multiple disulfide bonds
Strict full-structure verification and batch stability control for every production lot
Complete production traceability records for each batch of Lepirudin
Flexible supply: gram-level lab samples to kilogram-level bulk peptide orders
Global export service covering more than 70 countries and regions
Professional technical team supporting anticoagulation peptide research consulting

FAQs About Lepirudin Powder

Q: Where can I buy Lepirudin powder from China?

A: HDM BIO is a China-based peptide supplier providing high-purity Lepirudin powder for global pharmaceutical R&D teams and biotech laboratories. We offer small research samples and large bulk orders, supported by complete export documents and worldwide shipping.

Q: What documents should a qualified Lepirudin supplier provide?

A: Reliable suppliers can offer batch-specific COA, HPLC purity chromatogram, LC-MS identity verification report, MSDS and complete production traceability records for quality audit and customs clearance.

Q: What is the CAS number of Lepirudin?

A: The CAS registry number of Lepirudin is 138068-37-8.

Q: What purity grade of Lepirudin powder can you supply?

A: Standard research grade ≥98% HPLC purity. Higher purity specifications can be customized for special experimental requirements.

Q: How should lyophilized Lepirudin powder be stored?

A: Store sealed at -20°C, protected from light and moisture. Avoid repeated freeze-thaw cycles to maintain peptide structural and biological stability.

Q: Can I obtain Lepirudin samples before bulk cooperation?

A: Yes. We provide milligram to gram-level trial samples attached with complete COA and test documents for laboratory evaluation.

Q: What is the MOQ for bulk Lepirudin powder?

A: MOQ is flexible based on purity grade and packaging requirements. We support small research batches and large-scale bulk orders to satisfy different project demands.

Q: What is the amino acid sequence of Lepirudin?

A: LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ

Scientific Review

Reviewed by: HDM BIO Peptide Technical Team Expertise: Peptide synthesis Modified peptide raw material manufacturing Analytical chemistry & HPLC/LC-MS testing

Last Updated: August 2026

Disclaimer: All product content is provided for academic research and laboratory raw material reference only. Not intended for human clinical use, diagnosis or treatment.